SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159041696|ref|YP_001540948.1| from Caldivirga maquilingensis IC-167

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159041696|ref|YP_001540948.1|
Domain Number 1 Region: 63-140
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.63e-22
Family FHA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159041696|ref|YP_001540948.1|
Sequence length 146
Comment FHA domain-containing protein [Caldivirga maquilingensis IC-167]
Sequence
MPTGLDAAMHNNKGNATLNVKDLGAETTSRVEQKPVKRIRITFIESTTDSLKNTAVDLDV
VYFDSITIGRAPDNIVVIPDITVSRRHAVISRDSSGSIVLVDLNSKNGTYVYNNGVFERV
NKVELKDGIVIRLGIYTIIRINLIQG
Download sequence
Identical sequences A8MDV2
gi|159041696|ref|YP_001540948.1| WP_012186177.1.60673 397948.Cmaq_1130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]