SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158315293|ref|YP_001507801.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315293|ref|YP_001507801.1|
Domain Number 1 Region: 114-244
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.28e-19
Family GntR ligand-binding domain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 45-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000015
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158315293|ref|YP_001507801.1|
Sequence length 270
Comment GntR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MATPGYLGPRDGMPGSDEWAGAGAGPAAVADAGQGRPRRLRLGATARDRVADVLRDEIMS
GRLGPGARIDLDETAAWLGTSRTPVREACLALQFEGLVRVAPRSGVTVIGLRRRDVEDNF
ALIAMLSGAAAAWAAERISEAHLAELRHLAADVRSAVETGGDLRTANFLFHRAVNQASDS
VRLIALIRQTGRIIPWSFFDLVPEQVGCALREHDDIVDAIAAHNGARARRVSEEHVVSAG
RLLVARVFGPGPAGAGSTAAGPAAGAGAGG
Download sequence
Identical sequences A8KXW1
298653.Franean1_3493 gi|158315293|ref|YP_001507801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]