SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316371|ref|YP_001508879.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316371|ref|YP_001508879.1|
Domain Number 1 Region: 14-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.18e-16
Family LexA repressor, N-terminal DNA-binding domain 0.09
Further Details:      
 
Domain Number 2 Region: 83-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000016
Family GntR ligand-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158316371|ref|YP_001508879.1|
Sequence length 229
Comment GntR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MRSRLLASGRRRYGNLKDEAADFIREAIVSRALPPLSKIDQDEVADALGISRAPVREALI
ELAQKGFVDAVPRRGAFVAEVTVEDIEDHYEVVALVSGMTTRRAVRKLTPLETEELARLH
REIATTEDEARRRSLDRRFFQIIATAGKSPRLDAILEFLGGVLQGSLYYDSPAWVDNEAR
YRELLLAEIRAGDVVTAARTSEEHVRSCAAVTVEHLRTRGYWTTPPAAP
Download sequence
Identical sequences A8LD99
gi|158316371|ref|YP_001508879.1| WP_020462098.1.9268 298653.Franean1_4602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]