SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316465|ref|YP_001508973.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316465|ref|YP_001508973.1|
Domain Number 1 Region: 11-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.79e-20
Family GntR-like transcriptional regulators 0.012
Further Details:      
 
Domain Number 2 Region: 85-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.28e-16
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316465|ref|YP_001508973.1|
Sequence length 236
Comment GntR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTQPTPTQSSPARSNVQALVDTIRGRIIRGQFAPGQRLKEEWLAAEFGVSRIPMREALRA
LASEGFVRSERYGGTFVATLDAEAAHDLLDVRAVLEPLAAAQAAMRCTPEHLETFRRLLD
EGDRAFRERRPEDTRTVKGQLYEHLALASGNSTLIALMRVVRFKIEWATSIELIEQIPEE
TRNLRAKLVRDMVDAMADRDPARAATAAAAIIDATYASQGWRRVVEARFEAASKSP
Download sequence
Identical sequences A0A1S1PYS6 A8LEK5
298653.Franean1_4700 gi|158316465|ref|YP_001508973.1| WP_020462189.1.13248 WP_020462189.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]