SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316544|ref|YP_001509052.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316544|ref|YP_001509052.1|
Domain Number 1 Region: 107-243
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-18
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000001
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158316544|ref|YP_001509052.1|
Sequence length 259
Comment regulatory protein GntR [Frankia sp. EAN1pec]
Sequence
MVAEPGKARNRDRATLREKPQRIADEIRQLIVEGDLSEGESLGHEPDLVERFRVSRPSLR
EALRILETEGLISVKRGVLGGVVVHRPDQRMTARTAALVLQARNVPLADVHAARSLLEPV
AVRLVAASGDHRSAAAELRRLTAEQLEVIDDPEAFGNANSRFHARLVELAGNQTLGIVAE
MLNEIVARAVAAVSQPEDGKETTETRLRGLRSQARLATLVEAGDATAAEEHWKEHMTVVG
KVILTQGAKTVIDLMQHQY
Download sequence
Identical sequences A8LFU3
WP_020462268.1.9268 298653.Franean1_4780 gi|158316544|ref|YP_001509052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]