SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316653|ref|YP_001509161.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316653|ref|YP_001509161.1|
Domain Number 1 Region: 2-258
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-82
Family Cgl1923-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158316653|ref|YP_001509161.1|
Sequence length 280
Comment hypothetical protein Franean1_4890 [Frankia sp. EAN1pec]
Sequence
MIEFSGVGQLRSPVVVAAFEGWNDAADASSAAVEHLENVFGARVIGAIDPDDYYDFQVNR
PTVSGADGASRKIAWPTTRLSVARPAKSESDLVLVRGLEPNMRWRGFTDELIEAVHALGS
DMVITLGALLADSPHTRPVPISGTAGDPATAARLGLEASRYEGPTGIVGVFADACSRAEL
ASVSFWAAVPHYVANPPCPKATLALLRRVEDLLDMEIPLGELPDKAKAWERQVDELAAGD
TEVAEYVRSLESREPETALPEASGDAIAREFERYLRRRGE
Download sequence
Identical sequences A0A1S1Q2N9 A8LH65
WP_020462373.1.13248 WP_020462373.1.9268 gi|158316653|ref|YP_001509161.1| 298653.Franean1_4890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]