SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316964|ref|YP_001509472.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316964|ref|YP_001509472.1|
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Cgl1923-like 6.54e-84
Family Cgl1923-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158316964|ref|YP_001509472.1|
Sequence length 307
Comment hypothetical protein Franean1_5208 [Frankia sp. EAN1pec]
Sequence
MLDPRELYEIRSDLDDLGRPVLIEAMTGVVDAGGAVGLASEHLTTALQHERIVTFDVDQL
MDYRSRRPPMVFYEDHWESYDDPVLAIELLHDEAGTPFLLLCGPEPDLHWKRFTKAVQAV
MAELGVRMSVGLNAIPMAVPHTRPCGVTAHATRKELLVGYEPWVRRLSVPGSAGHLLEYE
IGRSGADAMGFAAHVPHYLAQATYPAATEALLSSVSKSTGLLLPLDGLRSAALEVRGEVD
SQIARGGEAADVVKAIEEQYDAFHRGREGEHLPVVDDSEPLPTGEELGAALERFLAEQSE
PGGPQPT
Download sequence
Identical sequences A8L0N3
WP_020462680.1.9268 gi|158316964|ref|YP_001509472.1| 298653.Franean1_5208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]