SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158317318|ref|YP_001509826.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317318|ref|YP_001509826.1|
Domain Number 1 Region: 1-380
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.19e-61
Family Gtf glycosyltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158317318|ref|YP_001509826.1|
Sequence length 387
Comment hypothetical protein Franean1_5567 [Frankia sp. EAN1pec]
Sequence
MDVLFASLPAYGHLYPLIPLAVACQDAGHRVRLATGEPFLGALPVPTVQGTPAGWTLQYV
EGETARRHPDATGVEFPVAMFADVAAEGVMDALEPLFAADPPEVVVADSANLGAVIAAHL
AGVPAVIFGVGQWSPFGEMTFPAALAAHRSRWTAAGLVAPGEPGEVIAAYLEPFPPGLRQ
EPGPGGVPVLPIRSTAWAGAQAPVPGWLTAPAERPRVYVTLGTVSFGAVEVIRAVVDDLA
ALDVDVLVAAGPEGDPAALGALPERVRVERFVAQSRVLGLVDVAVHHGGSGTVLGALANG
VPQVLLPQGADHFHNAQLLAERGAARVFHNEARQPGDVAAAVRDLLGDAPERRATATLAA
QIAASPTPADVVAAIAAIAEAAAKTRR
Download sequence
Identical sequences A8L5W3
gi|158317318|ref|YP_001509826.1| 298653.Franean1_5567 WP_020463024.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]