SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158317456|ref|YP_001509964.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317456|ref|YP_001509964.1|
Domain Number 1 Region: 26-166
Classification Level Classification E-value
Superfamily Sortase 0.000000000000124
Family Sortase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158317456|ref|YP_001509964.1|
Sequence length 167
Comment peptidase C60 sortase A and B [Frankia sp. EAN1pec]
Sequence
MGTGTGAGTGTAAGTGAGSVQAADPVRVRIPAIAVSAPVVPLSLDGGGRLRAPDGFSETG
WNAAGPEPGETGTAVIAGHVDSRTGPAVFFRLRDLAPGDRVEVERADGSSVAFVVRRLAR
FPKDAVPAADVYGSTGAPALRLITCGGVFDQARSSYRDNVVVFADLA
Download sequence
Identical sequences A8L7C3
gi|158317456|ref|YP_001509964.1| 298653.Franean1_5708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]