SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158318583|ref|YP_001511091.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318583|ref|YP_001511091.1|
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.1e-16
Family GntR-like transcriptional regulators 0.027
Further Details:      
 
Domain Number 2 Region: 110-245
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000188
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318583|ref|YP_001511091.1|
Sequence length 271
Comment regulatory protein GntR [Frankia sp. EAN1pec]
Sequence
MSISRRGRVSQVRIAETVAAALRARILAGDGTDGYQLPTQDQLVQEFGVSYPSVREAIRI
LETEGLVTVRRGKVGGAEVHRPDEASAAYHLGLALQAGRVTLGDLATGLQTFEPLCAAQC
AAAPDRHERIVPVLRANVEATAGFVGTGSAFTHAAREFHELVVALTPNATIRHIVSSLVA
LWSAQEQAWAESAASRGAYPAEVEAEQVVRTHRRILTEITAGRAPAAERITRAHLTASQA
YLLDRFDDSVVTVTDARSRQADAVPNPIWRV
Download sequence
Identical sequences A8L294
gi|158318583|ref|YP_001511091.1| 298653.Franean1_6851 WP_020464253.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]