SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158318776|ref|YP_001511284.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318776|ref|YP_001511284.1|
Domain Number 1 Region: 55-353
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.28e-68
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000397
Further Details:      
 
Domain Number 2 Region: 352-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-20
Family Glycosyl hydrolases family 32 C-terminal domain 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|158318776|ref|YP_001511284.1|
Domain Number - Region: 700-785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000283
Family Alginate lyase 0.065
Further Details:      
 
Domain Number - Region: 545-655
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00147
Family Trypanosoma sialidase, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318776|ref|YP_001511284.1|
Sequence length 818
Comment glycosyl hydrolase family 32 protein [Frankia sp. EAN1pec]
Sequence
MSILVRLMRSSLTRVRFTAVTVALAAVFTSLLPAVPALAGQVSDYPEFPYPTTDYTEPLR
GQFHFSSRGGWMNDINAPLYHNGLYHVFYQHNPHSLLWETMHWGHATSPDLVHWTQKPIA
LEPGVHPHDLWSGAGVVDTNNTSGLQTGSEAPILVFTATNGVSINYSNDAAKTFQIYNQG
QKVVTPAGISRDPKVFWHAPSNRWVMVVWSDAGGNGVNIYTSPNLLTWTFRSRYAADWLY
ECPDLFSLAVDGDPGNTRWVMTDAGGEYVIGSFDGVTFTPEWTSPQRMDQGHNTFEGTFY
AGLTFNHMPDNRIVQMAWMRSNQGSVWTGNASFPAELGLRAYPEGIRLTRNPVGEIASLR
VDSQSWVNRDITPDPASDPLTSTFADTYEIIAEFDTATATASRFGFRLHTRSDGTFDRAV
TYDRTAQTLYGAPLAPINGRVRMRLLVDRGQLEIFGNDGKLSWTDNVNFNSAPSSQGVQL
YAEGGNVQLVSLQFHRLQSAWGSGESTLESNLAGPWHPAGGTWVDTTTGKQGTAGGDGFY
LSNQTGADFTYEGDLRLDTAVAAGITFRANSDATQQYTANVDANGLVKLWRPGRDIGIFY
TPISQGRTYHLKVVTSGSIIRVYLDHRPTPVIDAVDTAYTSGYFGTNVFGGTGVVQNANV
NATGFVSNLGATWRPATGLWTVPGAGVKGRVAGDGFYLSDQTGTNFTYEGDVKVINGVAA
ALTFRSNADATGHYTANVDTNGLVKLWRPGSVIGVFNTPIVEGRTYHLKVVANGPNIRVY
FDGGATPVIDAVDSTYSSGFFGVNVFSGVGVIQNVVTS
Download sequence
Identical sequences A8L4X9
WP_020464444.1.9268 298653.Franean1_7047 gi|158318776|ref|YP_001511284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]