SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157962996|ref|YP_001503030.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157962996|ref|YP_001503030.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-43
Family SMI1/KNR4-like 0.00000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157962996|ref|YP_001503030.1|
Sequence length 134
Comment hypothetical protein Spea_3179 [Shewanella pealeana ATCC 700345]
Sequence
MNDIIEQLQEMSETVPVPLELATFEQIVEVEEEILIPLPMELKEYLLYASDVICGSLEPV
TASDPNSHTYLSEVTSYAWSIGLPREFVPICQQGDNFFFISQEGQIQLWQDGEIDEEETW
ESFWDWAEDVWMRS
Download sequence
Identical sequences A8H7F8
398579.Spea_3179 gi|157962996|ref|YP_001503030.1| WP_012156396.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]