SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157963722|ref|YP_001503756.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157963722|ref|YP_001503756.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000173
Family Coronavirus S2 glycoprotein 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|157963722|ref|YP_001503756.1|
Domain Number - Region: 128-200
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0889
Family Mitotic arrest deficient-like 1, Mad1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157963722|ref|YP_001503756.1|
Sequence length 215
Comment hypothetical protein Spea_3911 [Shewanella pealeana ATCC 700345]
Sequence
MKKLITSAIVGTSLLLGGCQSAYYGAMEKVGYHKRDIMVDRVEDAKESQEEAQEQFSSAL
EEMQALLNHDGGDLEGAYNKAKDEYESAQDAADDVTNRIDKVEDVAEALFDEWQTEIGEI
SKASLRRNSESKLKETRRSYSQLVKSMRRAESKMEPVLTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSIDESNKFIASLENK
Download sequence
Identical sequences A8H9I4
gi|157963722|ref|YP_001503756.1| WP_012157102.1.79101 398579.Spea_3911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]