SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163867486|ref|YP_001608685.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163867486|ref|YP_001608685.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-19
Family Thioltransferase 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163867486|ref|YP_001608685.1|
Sequence length 74
Comment putative glutaredoxin [Bartonella tribocorum CIP 105476]
Sequence
MSITIYSKPSCVQCDATRRAFDAKGIHYRVVDISCDEQAYSFVQSLGYRQVPVVVCGENH
WSGFRPDMISGLCA
Download sequence
Identical sequences A9IMK7 C6ABK2 J1A477
gi|163867486|ref|YP_001608685.1| 382640.Btr_0210 634504.Bgr_02020 gi|240849858|ref|YP_002971246.1| WP_005774163.1.101692 WP_005774163.1.1514 WP_005774163.1.30552 WP_005774163.1.32533 WP_005774163.1.42955 WP_005774163.1.58610 WP_005774163.1.62363 WP_005774163.1.76171 WP_005774163.1.90605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]