SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163867841|ref|YP_001609045.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163867841|ref|YP_001609045.1|
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-25
Family Thioltransferase 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163867841|ref|YP_001609045.1|
Sequence length 84
Comment glutaredoxin [Bartonella tribocorum CIP 105476]
Sequence
MKEIIIYTRPGCPYCTKARDLLDKKDVKYKDIDASTSLRQEMVQRANGRNTFPQIFIGDY
HVGGCDDLYALEAEGKLNSLLQDL
Download sequence
Identical sequences A9IQF1
WP_012231143.1.76171 WP_012231143.1.90605 382640.Btr_0611 gi|163867841|ref|YP_001609045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]