SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163868700|ref|YP_001609912.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163868700|ref|YP_001609912.1|
Domain Number 1 Region: 30-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.89e-42
Family Glutathione peroxidase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163868700|ref|YP_001609912.1|
Sequence length 193
Comment sco1/2 family protein [Bartonella tribocorum CIP 105476]
Sequence
MKNVIRIFSLTVIFLGGVFIYDIFVNKPLGDNFTLTDSNGKTITEADVRSKPSIIFFGFT
MCPEICPTTLMNLDRWLTALGPKADKLGKWFVTVDPERDTPEVLHEYLSNFTNEIVGISG
DPEKVHKMVNSFNIVAEKVPGTDGNYTYDHTAAIFLLKKGGKLAGVIRYEPKEDDNELKD
EITIERLKKLVSN
Download sequence
Identical sequences A9IW92
gi|163868700|ref|YP_001609912.1| WP_012232043.1.76171 WP_012232043.1.90605 382640.Btr_1578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]