SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163869285|ref|YP_001610541.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163869285|ref|YP_001610541.1|
Domain Number 1 Region: 84-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.21e-32
Family Glutathione peroxidase-like 0.0000886
Further Details:      
 
Weak hits

Sequence:  gi|163869285|ref|YP_001610541.1|
Domain Number - Region: 33-73
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0863
Family Methionine synthase SAM-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163869285|ref|YP_001610541.1|
Sequence length 232
Comment Thiol 3-disulfide interchange protein [Bartonella tribocorum CIP 105476]
Sequence
MIPQSFNNSKKKNKKWKIFITSFFVAIILVGISLYAIKNHHDKSAYFSTNFISKENTEKI
QDKKMMTLQKAATGFFAHMRFIDTPLDMNSLSFKDIQGKDHTLAEFNGKSILLNLWAIWC
VPCRTEMPELAQLKRELGGKNFDVIAINIDKAASPEKIQQFLQNIHADNLIYYRDETMNI
FNDMRKQGLALGLPVTLLIDKNGYLIASYNGAAPWANNDAKALIKAVIKEAQ
Download sequence
Identical sequences A9IZG9
WP_012232580.1.76171 WP_012232580.1.90605 382640.Btr_2594 gi|163869285|ref|YP_001610541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]