SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163867896|ref|YP_001609100.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163867896|ref|YP_001609100.1|
Domain Number 1 Region: 44-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-37
Family DsbA-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163867896|ref|YP_001609100.1|
Sequence length 218
Comment hypothetical protein Btr_0671 [Bartonella tribocorum CIP 105476]
Sequence
MIKYRSFLFFGIIFLFITIVQNSVAVALARGIKPVATVDMAELLQSGKVKDRVEGEADAP
VIIVEYASLTCTHCAHFYNDILPQIRKKYIKTGKVKMIFRDYAFDPRATAGFMLARCAPE
DRYFPLIEVLFQKQNEWVWGKDALTPLKKISLMAGFTDESFTACLKNQTILDEVNASFER
GKELGVSATPTFFINGDKYEGAMKVEEFFSLIDSYLKN
Download sequence
Identical sequences A9IQV5
382640.Btr_0671 gi|163867896|ref|YP_001609100.1| WP_012231210.1.76171 WP_012231210.1.90605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]