SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163868346|ref|YP_001609555.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163868346|ref|YP_001609555.1|
Domain Number 1 Region: 6-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.35e-48
Family Glutathione peroxidase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163868346|ref|YP_001609555.1|
Sequence length 161
Comment bacterioferritin comigratory protein [Bartonella tribocorum CIP 105476]
Sequence
MIKSMKGTLAPDFNLPRDGGETICLSDFRSKLVVLYFYPKDDTSGCTSEALDFTQLKTKF
EEIGVAVIGISPDNVKKHDKFKQKHGLDVILVSDEEKTTLEAYGVWVEKSMYGRKYMGVE
RSTFLIDANGKIAEEWRKVSVSGHAENVLAAATLLHRNDGV
Download sequence
Identical sequences A9IUI1
382640.Btr_1189 gi|163868346|ref|YP_001609555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]