SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBX90218 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX90218
Domain Number 1 Region: 153-338
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.06e-38
Family Hypothetical protein AT3g04780/F7O18 27 0.00041
Further Details:      
 
Domain Number 2 Region: 57-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000402
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CBX90218
Sequence length 355
Comment pep:novel supercontig:ASM23037v1:FP929064:529432:530551:1 gene:LEMA_P063440.1 transcript:CBX90218 description:"Similar to thioredoxin-like protein "
Sequence
MSGTLEISSPGQLSTLLSSSRIVVVNCKQMTTPDTANKLSILMIACYSVYNENNTSSTAI
APVYEKLAGQLSRANRVTFAKVSTVKQAQIAQSYNITNTPTFIVFKNKQQVSKYGGSNPQ
QLSEAIKKLAAEAETDGGGSGGFGEASSSGSAGWRGATLPRGYSDVTDSVDVRGLDLLNA
DSDFGGVRTLFETSPPSALNKGKAAASGSEGSKDWIESDVDNQLMLYIPFTANLKVHTIH
ITSCVSDDDDDDEAPCRPKTIHIWTNRQHNLGFEEAEDVPATQTIELKNSDWDTETATAK
LELRFVKFQNVYSLVLFVADADGDSEKTRIDRIRLIGETGEKREIGKLEKIGQDD
Download sequence
Identical sequences E4ZFZ8
XP_003833583.1.65998 CBX90218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]