SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157825637|ref|YP_001493357.1| from Rickettsia akari str. Hartford

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157825637|ref|YP_001493357.1|
Domain Number 1 Region: 199-358
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 8.63e-65
Family RalF, C-terminal domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 9-195
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-54
Family Sec7 domain 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157825637|ref|YP_001493357.1|
Sequence length 649
Comment hypothetical protein A1C_02770 [Rickettsia akari str. Hartford]
Sequence
MDKMDSLVQNEVIKLFNDKPKSGIVRIKQWCADNNKDFAKETAQFFYEEKSNLNLEFVGD
YLGTDGIDNKTVLESFTKQLNFKEKDYLESLRGFLQSFKLPGEAQKIDRLVESFGTNYYE
QNLNGEIKSKDAAYILAYQTIMLNTDLHNPSIVKPKKMTFEQLKNNLKGTNESQNFNDTF
LKKMYDGIKAKPFVLNFVDSSPGYEIYNISSQNDQTFKKLNKFLEEKSTIQDVFSKLQNN
NLTAEFKNPKTLLNKFTGYEGSVIVKDEKGGKATIQVYKPSVFSRWFLGEKSKIIIQPLS
EEGKQPSEQSLTLASQITASFETKVTSVKATYDYLKEDLKSRYENISNPKQELERASSIA
ELHKNIKEITEIVQQTNQQIPEKPLASKEIFEDLTQAEIGIKPVEILIKSSYQQVKKPKF
NSFIEELAWKSAQRKQNVDTPINQNKEPKIQTDNHAKVLEELKQKQKALEDKKKGLEEKK
SNSNITREERWKIVAELESINNQFQAIEKEYNIINSASDREKKFDNKNNPSSPTKGAPTA
ADLQQQGALAAIKRMKEEKIKQQQAEAANQASQITPTMSSGTIPVPPPMPGSGIPVPPPP
PSIPNIVKKEAQDIGKQIPQEGDKHKEGLVKAMEAQRKKIEKQNSGRGM
Download sequence
Identical sequences A8GN74
gi|157825637|ref|YP_001493357.1| 293614.A1C_02770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]