SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157825901|ref|YP_001493621.1| from Rickettsia akari str. Hartford

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157825901|ref|YP_001493621.1|
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000471
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157825901|ref|YP_001493621.1|
Sequence length 143
Comment ankyrin repeat-containing protein [Rickettsia akari str. Hartford]
Sequence
MRNNDVDQDLSLISKLIEANQCQKFNGDLRNRDPEETYYEVYYPFLSVAVLKRNLTMLTI
LLEYDFKPHAISSALNPETTPLIEASRCGRVDMVLKLTSILNKDELNYYDHDIKNSALYY
AIQNNLRFATFSISILLLPKNTL
Download sequence
Identical sequences A8GNY8
293614.A1C_04205 gi|157825901|ref|YP_001493621.1| WP_012149743.1.98304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]