SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157825968|ref|YP_001493688.1| from Rickettsia akari str. Hartford

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157825968|ref|YP_001493688.1|
Domain Number 1 Region: 49-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-53
Family Glutathione peroxidase-like 0.0000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157825968|ref|YP_001493688.1|
Sequence length 205
Comment sco2 protein [Rickettsia akari str. Hartford]
Sequence
MKMQSNIIKIIIVISLLIGVGALYLLLSLSTPEKPLAGQVNIYEDNVNIGGDFELIDQNG
EIFNSETLKGNLSLVYFGFTSCPDICPTSLNNMTKIVEILNKHKIDILPIFITIDPKRDT
PEVLKEYLKHFHPKFIGLTGNEQQIKDVADKFKVFYARVNGDDDDPNYMLDHSSFTYLID
ANGKYLKHFYLDSSPKDIMEFLRNE
Download sequence
Identical sequences A8GP55
gi|157825968|ref|YP_001493688.1| WP_012149810.1.98304 293614.A1C_04570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]