SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000000880 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000000880
Domain Number 1 Region: 39-368
Classification Level Classification E-value
Superfamily Terpenoid synthases 1.22e-81
Family Squalene synthase 0.000000000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000000880   Gene: ENSLOCG00000000791   Transcript: ENSLOCT00000000884
Sequence length 417
Comment pep:known_by_projection scaffold:LepOcu1:JH591413.1:268605:283567:-1 gene:ENSLOCG00000000791 transcript:ENSLOCT00000000884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDILKSLGHPEEIYNLFKFKMGGCRTVMPKLDCESMSESLRTCYLYLNQTSRSFAAVIQA
LDGELRHAVCIFYLVLRALDTVEDDMTIPLDKKVPLLHNFNTFLYQEDWRFTESQEKDRQ
VLEDFPTISLEFRNLGQEYRDVIFDICHCMGVGMAEFLEKKVGSMKEWDKYCHYVAGLVG
IGLSRLFSASQLEDPEVGRATDLANSMGLFLQKTNIIRDYLEDQKEGRAFWPKEAWSQFA
ARLEDFAQPQHLDSALSCLNLLVTDALRHVPDVISYLSRLRNQSVFNFCAIPQVMAIATL
SACYNNPQVFQGVVKIRKGQAVTLMMQATSMGAVRVIISQYIQEIRQKVSPTDPTQDRTL
QILDSIRDKNLSQDPLPSRVSSLSPVYLSAAMLLAALSWQYLSATTGQNSTGNMQGH
Download sequence
Identical sequences W5LXM3
XP_006642983.1.81211 ENSLOCP00000000880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]