SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000000889 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000000889
Domain Number 1 Region: 274-467
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-53
Family Ypt/Rab-GAP domain of gyp1p 0.003
Further Details:      
 
Domain Number 2 Region: 445-541
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.46e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000000889   Gene: ENSLOCG00000000798   Transcript: ENSLOCT00000000893
Sequence length 587
Comment pep:known_by_projection scaffold:LepOcu1:JH591442.1:179328:189047:-1 gene:ENSLOCG00000000798 transcript:ENSLOCT00000000893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGESHKVLFEKEGVYLHTNTKRSSQDSAIPGVIRVVERGGEPALEWSPLEEERGTTP
HVVFSKKDGDAEGEEETNFDPGYEPDWAVISRVKIHPQQGEKERETGDWSSFSLPLSELY
SLRRSRFSLGKNFLVLTSRGGAPLPALHFHRGGTRELLKALQRYIILAPSPLDGRLFLAC
PHDSGALSQSFDGLHMFEDGAPDLVSRFIQDPYATTFGGFSKVTNFFRGALRQPESPLRR
NNGGSEDEPGFEVITCGAELGPRPEVKRGEPLDKWEEFMDGEGRVQNPQQIKEMIFRGGI
SPALRKEAWKFLLGFYPWDSTVKQREDILRQKTDEYFRMKVQWKSISEEQEMRNSLLRGY
RNLIERDVNRTDRNNPFFSGSENPGLTLLHDVLMTYCMYNFDLGYVQGMSDLLSPILFVT
QNEVEAFWCLTGFMELVHQNFEESQEAMKQQLLQLNILLRTLDPELCDFLDSQDSGSLCF
CFRWLLIWFKREFSFEDILTLWEVMWTGLPCANFHLLLACAILDSQRGELMGSDYDFNMI
LKASRHRARWRVVVPPLSLCCGGGRCFSVICITLILSLTPVSLPLND
Download sequence
Identical sequences W5LXN2
XP_015194934.1.81211 ENSLOCP00000000889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]