SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000001503 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000001503
Domain Number 1 Region: 76-185
Classification Level Classification E-value
Superfamily TRAF domain-like 3.07e-17
Family SIAH, seven in absentia homolog 0.0061
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 5.61e-17
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 244-301
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000276
Family PDZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000001503   Gene: ENSLOCG00000001323   Transcript: ENSLOCT00000001508
Sequence length 329
Comment pep:novel scaffold:LepOcu1:JH591411.1:799923:802467:1 gene:ENSLOCG00000001323 transcript:ENSLOCT00000001508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDVELFVDSVDPDFRCRLCTKVLEDPMSTPCGHVFCAGCILPWSVKQRQCPLYCKPIS
AKELHQVLPLKNLIEKLIIRCLYHSRGCIKKVKVQDLGYHTEMCDYSPSRCRNKGCNEVL
SLKDMDTHMRESCDCRPVEMCQNGCGLLLLHKDIVHGNHCCLNALRAQSGALQVKSANVE
QAAKRQGIRLARRENSLLARVSALQNEVHLTALTYQMRFNRYKIYINNLSKHVTGRCKGG
ELQRLSIALHREKDSLGFNIIGGILLQEESTPEGIYVSKILERAPADKAGLQLHDQIIEV
GPSLPCCNCTNSSSCLLTVDVSKFTLVLV
Download sequence
Identical sequences W5LZE6
ENSLOCP00000001503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]