SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000001968 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000001968
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-26
Family PDZ domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000001968   Gene: ENSLOCG00000001710   Transcript: ENSLOCT00000001973
Sequence length 200
Comment pep:known_by_projection chromosome:LepOcu1:LG13:2020361:2039804:-1 gene:ENSLOCG00000001710 transcript:ENSLOCT00000001973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEHHPRMCHLKRSEAGYGFNLHSEKSKPGQFIRSVDPGSPAARAGLRPQDRLIEVNDVN
IEGMKHSEVVAFIKSSGTEARLLVVDAETDEYFRKLGVTPTESHVKGFVSQPITNGSPKP
QINGSSTADSSQSELQSPDRTTELKQVEEQEEGNKDPFAESGLRLSPTAAEAKEKAHAKR
AKKRAPQMDWNKKHEIFSNF
Download sequence
Identical sequences W5M0R1
XP_015215329.1.81211 ENSLOCP00000001968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]