SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002160 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002160
Domain Number 1 Region: 72-251
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-50
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 226-338
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002160   Gene: ENSLOCG00000001862   Transcript: ENSLOCT00000002165
Sequence length 647
Comment pep:known_by_projection chromosome:LepOcu1:LG27:4535899:4579420:1 gene:ENSLOCG00000001862 transcript:ENSLOCT00000002165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKDIETLIAEERAEIISKYDKGRHEGVEIDPWEDADFNIYKVTDRFGFLHEEELPTPSA
LEEKQKQQEIERVDKWLKMLKKWDKYRNSEKMLRRVYKGIPLHLRGQVWSVLLEVEKLKN
ENVGKYEKMKEQARSYSTEIKQIDLDVNRTFRNHIMFRDRFDVKQQALFHVLAAYSVYNT
EVSYCQGMSQIAAILLMYMNEEDAFWALSQLLTNQKHAMHGFFIPGFPKLQRFQVHHDQI
LSKLIPKLKKHLDKEQMSTGIYTTKWFLQCFIDRTPFTLTLRLWDIYILEGERILTAMAY
TILKLHKKRLLKMSLEDLREFLQEKIAGSFSLNDDSVIEQLQASMLELRKMKLDLPPPAK
PEEFPKNPLGQELPVLLVPVKPCQAANDKSKTVPGTVDLRTDREQETVLPDKSPSPLHER
DPKTPNGENVTLPSPSPVMVHSHESGAGPTPQKTEVLPESKYQSTPYLRLRIEFQGERTQ
GEPSEWPPPYEPPETAGDPVALPVQLLEEHLPLPPPPPPLPQAEVPQAEMPCPGIPPKPP
DLAPLRISEDPSCADVDATGFPGSLGVPGHSGERRSSNTSHYDNMEEGAEDPYPHVLPDS
AAALTPPEPPEGSSSLPVPPESNDPMMFPPPPPPVAFFPPKQAALPP
Download sequence
Identical sequences W5M1A3
ENSLOCP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]