SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003435 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003435
Domain Number 1 Region: 119-259
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-27
Family DEP domain 0.007
Further Details:      
 
Domain Number 2 Region: 30-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-26
Family DEP domain 0.0024
Further Details:      
 
Domain Number 3 Region: 320-398
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000011
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003435   Gene: ENSLOCG00000002918   Transcript: ENSLOCT00000003442
Sequence length 402
Comment pep:known_by_projection chromosome:LepOcu1:LG18:6470120:6482890:-1 gene:ENSLOCG00000002918 transcript:ENSLOCT00000003442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENVGNYVKKKAAERQYKAEVMIAGEQLRLRLHDGKLIKDRRCYLRTYPNCFVAKEAIDW
LIAHKEAPDRETAVRLMQHLMAHDIVHHVCDRHSEYKDAKLLYRFRKDDGTSPFNTEVKV
FMRGQSLYERLVAGKDSIMKEHEEKGVKYQRAFPGFEMIDWLLHNGEIPNRREGVDLCRT
LLDHGIVQHVALRHHFFDSGLLYQFCINFRRRRRLAELLSESENRGAPLGQEEASDSPFT
LRKTAPEEGNTSFLSVQPNKEIKLVSAVRRSSTTSLSGGAGGYFSIPPSFNNAAPVKCNP
KSVLKKKVTIEELMDAGAPYMRKSITIVGDAVGWGFVVRGESPCHVQAVDPGSPAAAAGI
KAGQFVFQVNGVCVLDLDYKTLSRLIMTGPRILVVEVMESLE
Download sequence
Identical sequences W5M4X7
ENSLOCP00000003435 XP_006639558.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]