SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004047 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004047
Domain Number 1 Region: 103-217
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000004047
Domain Number - Region: 19-45
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00314
Family Ypt/Rab-GAP domain of gyp1p 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004047   Gene: ENSLOCG00000003422   Transcript: ENSLOCT00000004055
Sequence length 283
Comment pep:known_by_projection chromosome:LepOcu1:LG5:4118826:4122977:-1 gene:ENSLOCG00000003422 transcript:ENSLOCT00000004055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKEVMDQNPGKFEALEREPGDPKWLDIIEKDLHRQFPFHEMFAARGGHGPAHTLRHCPCA
RRHTHTLKHCETLSPRTHTHRDTARHCPRAHTHTETLRDIVPLDGEIFFSLLRRVCPMAY
RHLKKFKIDPILYMTEWFMCVYSRTLPWACVLRVWDMFFCEGVKIIFRVGLVLLRQMLGS
VQQLRECQGMYETMERLRNIPPDNVKEEALVHEVISLPVTEALIERESKVQVKRWRETRG
ELQHQPCRRLHGTRAIQEQRLRSSHASLPPPAGPLRSSASLLS
Download sequence
Identical sequences W5M6N9
ENSLOCP00000004047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]