SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004089 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLOCP00000004089
Domain Number - Region: 120-214
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00191
Family Ypt/Rab-GAP domain of gyp1p 0.021
Further Details:      
 
Domain Number - Region: 337-388
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0157
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004089   Gene: ENSLOCG00000003448   Transcript: ENSLOCT00000004097
Sequence length 699
Comment pep:novel chromosome:LepOcu1:LG22:3883151:3894686:1 gene:ENSLOCG00000003448 transcript:ENSLOCT00000004097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMTGVASSAPQWLLKARTIIENSKEWKAFTADLFEAVQQQQTENHVSFFADLSEAEKALF
LERAAKAICRGNAHKDVIAHIGSSLENILSGVVAAQMSDSGAVSTKSDLFQSHVRDGMVN
LLHKWPDMKSKLHILFNHSLPSEIRKVAWRLYLSNTKARMDYLTLMSMNKVRSKADLDIS
QQCEALLSREPTFRSVKENTIGSKAMRNVLSYYHRMQHFKTRLPDSECVLLIPLVEASVA
DATPSTSVDTVTTLLVEEYITFMECRPAFMRSQSPGARDDAGSEEVFAEVAQMLDQKEQE
LSNAVREIHARQVHLFTCDSPHQSLLRGVKAILQPILTVFFVGYLNMTTLLYIWDQYIIG
IDKPSYSCVPAFSFAFIQLLKDHLQACRTEGELAEVPKSRGPALVVQQFRGVISKHFHGD
LYSALTRDEAETFPILDPVQAFFPPWTHLSSKELPLRTRPKDRRLAREERAARRADQQQR
AEREEQLQRLRAEEEEERLQRQLEETKRVGSEQKLFLEEQLAQERQHRYEMQKRAEEQIS
QLQAEIKKIREEKLVAIPGTPPPSPESKTSRLDRPPSPAPQHAPPPAVPIAVSAVRQVNG
RTPGSVAADLLQAVMQTANTIVNGHNMEREELDSSTQDQLHSYREAVRNAELEVCGRYLD
ADEVEHMTEPVKSELKKRLAAAVKRGVEARYRARVMQAK
Download sequence
Identical sequences W5M6T1
ENSLOCP00000004089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]