SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004233 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004233
Domain Number 1 Region: 751-827,859-948
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-34
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1108-1281
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 955-1053
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.7e-17
Family Lipoxigenase N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004233   Gene: ENSLOCG00000003559   Transcript: ENSLOCT00000004241
Sequence length 1288
Comment pep:known_by_projection chromosome:LepOcu1:LG27:7597438:7656388:-1 gene:ENSLOCG00000003559 transcript:ENSLOCT00000004241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTGFSSNSCRFADYFVICGLDTETGLEPDELSALCQFIQASKIRDGAGRCSASADEGEN
FEQSPLRRTFKSKVLAHYPENVEWSPFDQDAVGMLCMPKGLTFRTQADSREPLFHSFIIT
REDGSRTYGFTLTFYEEVTSKQICSAMQTLYHMHNAEQYDILHTTSSSSSTNGRDCGGSQ
EELGGTALSKLQRFNSYDISRDTLYVSKCICLITPMAFIQACRKVLQQLHQAVTSPQPPP
LPLESYIFNILYEVPLPPSGRSLKFSGVYGPIVCQRPSHSELPLFDFPVGELFELLGLEN
VIQLFTCALLEIQILLYSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLDAPV
PYLMGLHSNGQDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFIQEVSEVLMT
FGIPPEGSLHCSESVSKLKGFRACDVASDKRNGNLAGSPLNSYHLLKENETIARLQALVK
RTGVSLEKLEVRDEASSNKDLKVQCEEEELKMHQLNIRVREVFANRFTQMFADYEVFVIQ
PSQDKESWFSNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKILCHDDEDK
EPTLRVFDSRVDKIRMLNVRTPTLRTSMYQKCTMIDEAEKAIEMRLVKIDHTALHPHLLD
MKIGQGRYEPGFFPRLQSDVLSTGPISNNWPEVQCLLSLDWGWHEPSHRPSVKSVSEVDL
KYIQEARNLGTTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVEL
GHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALMQYIMNLLQILKKPLCINKV
KGFIQDTERRKSDTGPVMPPLKVSLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSR
HLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTVMIPYHVL
VIPSKKLGGSMFTANPWICISGELSETGVLQVPKNTLEITFECQNLGKLTTVQIGHDNSG
LYAKWLVECVMVRNEITGHAYKFPCGRWLGKGVDDGSLERILVGELVTPSTESEERFCRT
PPMQQSPSMIRRFVTISPNSKPKLNTGQIQEGVGEAINGIVKHFHKPEKERGSLTLLLCG
EYGLVSALEQVFLHGFKSPRLFKNVFIWDFLEKAQMYFESPEQREMVQDENWQTRVRNFC
RFMNAINSTPRSIGKDGKFQLLVCLGARDHLLHHWIALLADCPITVQMYEDMALIKDHTL
VNSLIRVLQTLQEFNITLETSLVKGIGI
Download sequence
Identical sequences W5M775
ENSLOCP00000004233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]