SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004494 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004494
Domain Number 1 Region: 438-513
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000523
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004494   Gene: ENSLOCG00000003767   Transcript: ENSLOCT00000004502
Sequence length 1288
Comment pep:novel chromosome:LepOcu1:LG22:4563841:4594682:-1 gene:ENSLOCG00000003767 transcript:ENSLOCT00000004502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHTPWLDSCLGDTLLPDKPWHKVYEKLGAALAKEVESHLRQNPQSQLPLGLLGGHFLEDY
LGKSSWMHCVKEQWRAAAVPEDLVMSHSKLYMPGPILYGILFGRDGDYSGVSQEMMHFIK
DTYHMVTSEMEQMLALEEKKQKEAPKFNSIESPSAWASMARRRPHSVESEDLHLATRRGS
VFQLKPKAEPGEIPAPPLHCAESQVLGRSVAAVLASDPGRMGTVCKRLKGQLLPESLRGA
IWIGQLLKPEAFSDADTFWTFEKTLREKFGRMVERRVAELKLRSATRSPISGLIENAVVE
KYERTPSMQAFATNEQMISESSKVLNILYVHSGIYEPYLIHWLFPLQMAFRQTDSKVFFL
AEHLYELSMYLHCLIQKFPCWPEIFAMAENVMRHVEENDPELFAHLQLCSSRNMVLDSKD
FLVELIAQEREKAQELLDFSDRIFLRKWMGEGFMSVLDLPAVLLVWDQLFMENWSRKVME
DVCLVVLMLLKDPLMAADDYQSMREVLLDHASHLFTADIQRSWMHLQQGGLPVDIPELNR
FNSSNVNLFECLAQISMGDILPIGLKDVVVNLILNLPKTDSLNHAWMKDFDPLAVKLITS
VLYGNVKLHSKSSLLTPSVEKRAPNKETTTEYKLLFNGTDIFIFDALDPSDIREISYLKD
KPAVVIKVIYVPNLYGSAPVTLGWVKADLFHEEKSGPQTQWTPSVFTAHLKLCTGADPEL
LTNHTSTHNLEEPLQKGSNIQVTVFDPSKESPRRGASHAELQSIYSFYCSDMKMQSLLIA
NVNNNIHAQTQTRESNQLSPRLDVSTTLPPEEPRFLYPPWVTHNASLAVPHQSSVYQPLD
LYIDSVQYIPDNATIVKVTGRILQSGQEDLPDISALPDLSSPARSPEFNFRMTVNPSNKK
PFDRHMLLLLRVYTVSSDTGELCVIGNCIIRVFNDLKPTPSYLSGFYLTDRAKPNKSELG
IIATFQRNRDFPKTVKEMMQQLENKEHANGASVPPELWLAWYEERLDARKQLPPQTPPAH
LSIHHMVRYHQQAGIRIRITQAFGLPAGGLYVNAFARILKGAESLHLAELPQGWGGEEKF
VTLRRDFTSLQRCPRWTDQSAVLHPYNDPHTVLLVQLFALHAVYRADPSGQRCGTVSALS
GEHLKLDSKSQLGWAVVPLFEGPYVWSGIHHVPIFQGNPDGVSASFAQLTLQNNEKQNMV
KNASLKSTFLYKAAIFKKKFLKTQSKKPGKEISQLVLQRLNRKIRKQGCSSEEYQREEQF
YEEAMGNTFYALMDQNSLVFVMSGHLLL
Download sequence
Identical sequences W5M7Y6
ENSLOCP00000004494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]