SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004889 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004889
Domain Number 1 Region: 532-596,898-1017
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0061
Further Details:      
 
Domain Number 2 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-34
Family RUN domain 0.00074
Further Details:      
 
Domain Number 3 Region: 995-1116
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004889   Gene: ENSLOCG00000004081   Transcript: ENSLOCT00000004897
Sequence length 1124
Comment pep:known_by_projection chromosome:LepOcu1:LG20:5685271:5735176:-1 gene:ENSLOCG00000004081 transcript:ENSLOCT00000004897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAMSEAETRQRLVRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRR
AAGFLRSNKIAALFMKVGKSFPLAEELCRKAQELEQIIENKRNQVPLNHESSRKLQKLPS
ISPQAVKHLWIRTALIEKVLDKIVLYLVENSSKYYEKEAVLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSAHCRQDSPTKRPALCIQKRHSSGSMDDRPSMS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAIPGYLSLHQTADIMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESVSDKEEDEATDYVFRI
LFPGSQSEFVPQDLMEQAPAMWHPTARKSSCSSCSQSASSDGGPLNGCNHERAPLKLLCD
NMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNHTIVDPDVPQDARGGLTAEIWQKYLQD
CTAYEEQELLRLVYFGGVEPSLRKEVWPFLLGHYQFGMSEKERKEVDDQVRACYEQTMSE
WLGCEAIVRQREKEQHAVALAKCSSGASLDSQIQKMMHRDSTVSNESSQSCSSDRHSHAQ
LQSDSSSSTQVFESVEEVEQIEMEPKGEEAKQATKVPNGVVPNGTCSPDSGHPSSRNFSI
TSGFSDRSLSTEDSAGAESTAKTSGQPQPPHPGSAKPAQQVVDPPGVKAPAQGPEEEPRE
QAAATAEDQGLEEALPPVTKARESASAEDSMVAKETSEELLSAIELPLGDDLGTGGVVGP
LVLEMQVDEEAEKQSLVGSEDALSEEPEMESLFPQFDSLAVGGEAKPDATSPVSSIGTTY
SQELLDMYTVNLHRIEKDVQRCDRNYWYFTPTNLEKLRNIMCSYIWQHLEIGYVQGMCDL
LAPLLVILDDEAMAFSCFTELMKRMNQNFPHGGVMDTHFANMRSLIQILDSELFELMHQN
GDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAAKYVSSSHFVLFIALALVELYRDII
LENNMDFTDIIKFFNEMAEHHNSKQVLKLARDLVYKVQTLIENK
Download sequence
Identical sequences W5M930
XP_006640394.2.81211 ENSLOCP00000004889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]