SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005046 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005046
Domain Number 1 Region: 638-744
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-25
Family PDZ domain 0.0027
Further Details:      
 
Domain Number 2 Region: 272-363
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-20
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 42-97
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000229
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 4 Region: 546-610
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000012
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005046   Gene: ENSLOCG00000004220   Transcript: ENSLOCT00000005054
Sequence length 748
Comment pep:known_by_projection chromosome:LepOcu1:LG3:5576766:5609186:-1 gene:ENSLOCG00000004220 transcript:ENSLOCT00000005054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTASMDTSVAVETNPALNPLCQDCGQQHWSRENHLYNYRHEVDDDLVCHICLQPLVQPL
DTPCGHTFCFKCLRNFLQEKDFCPLDRKKLHFKVCKKSSILVHKLLDKLPVSCPFSAACP
DSMPRCDLEAHLKHRCPGALNHRAGLERRRSERLPAPDGGGEGRAMGMEPPDSAHSPEPG
SAGDSPPGGSTACAAVPMWTDEHGLDNPAFEESTEEDSVHSLDCNPARAKRPLSNPCIHL
HRTSSTNSSGWDIPEDGPPPPAEEGCPKVPGLPEGEITTIDIQRSNPYMELGISVVGGNE
TPLINLVIQEVYRDGIIARDGRLLAGDQILQVNGVDISNVPHNFARATLSQPCPALQLTV
LRERRFSGRPXGASAATTACWASTGTTCGTAPPSSPLRSSRYCGDRGTGILGVVYTCMKD
SVKIHIWNIQRLGISTRIRRLLFLQRLQKMFEKTRRILQASGERVHLVICRPSKPLPPLP
SANANAVRDAGCHTIALPHPLHPPVSTAMQHLGRPSTHATHRVSPPPRHPGDRSESPLHH
TLQFGVTGDRGNCQRARRAQPGVCSSRCCSLEAGDVLLSINGMDLTSLSHSEAVATLKAS
AASSSVLLRALEVQTIEEQGQAAEETLPAAHDNDYDASWSPSWVMWLGLPSYLHSCHEIV
LRRSSLGSWGFSIVGGYEESHTNQPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTAGM
SHSALVPMLKEQRNKVALTVVSWPGSLV
Download sequence
Identical sequences W5M9I7
ENSLOCP00000005046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]