SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005436 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005436
Domain Number 1 Region: 1421-1495
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 979-1156
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000157
Family RUN domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000005436
Domain Number - Region: 613-660
Classification Level Classification E-value
Superfamily SARS receptor-binding domain-like 0.0445
Family SARS receptor-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005436   Gene: ENSLOCG00000004546   Transcript: ENSLOCT00000005444
Sequence length 1498
Comment pep:known_by_projection chromosome:LepOcu1:LG2:11337643:11354345:1 gene:ENSLOCG00000004546 transcript:ENSLOCT00000005444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILKRKRMDSPPKLSGETLIVHHIPLVHCQVPGRQCCGSLKRTNPFCQPDLGLTRTTSL
PERDVLHREALVYSSLIQTSSSSGGGGGGSSLKSRDPTGKANVLRHNPFLLDAEDDEGEE
LGGDEGDNLNGYLEDSSFHLHGNTNAASNKTSSFHLHDLALAAEPFLLHDSLRGVSGHNV
GALKTAKRLSDCLDLLELDCQGRHGSSGSTLSMDCGEQEWIGSPTEEEEDPLRNGHCSRP
CSCCSSSDFALHGQGHRCCCFSFSEPSENADHQMGYVSDSSCNSSDGVLVNFSAIYNKMN
NGGPAKPLNLNSEDQSCTSSVCSHSEAGGAFYLDLHTSPTEPRGGTNSSQDANTCSCHSP
QAVDANCNSYHLHCDGGSCHTETSDLTSCFQSQARLVVATQNYYKLVTCDLSSQSSPSPA
GSSITSCSEEQPKSSPSQPTEYYLFRKPEDQEAVMESKDNEQEQEGGKSGEEVLEPPQNV
IEGQLYVNISPPMLTGGGATGRPRSRSYDRNLDRSPPPRLGSLERMLSCPVRLSDSAARA
SPPPRVTSFAEIARSKRKSASLGGGSPPPKSSTSSSSQEFSPIPEPRHAGESRSLPPMPF
GRCYSQSSVTLHKSATFICNVRYQINGKMTSCIVLYILRGVNVVAMNSHYTSSTDTREQR
RTHHIITRHVDMKKGHRGSSEGRPVVRYSKDQRPTTLPIQPFIFQHQLSKQPKLRPLLSD
YVSQMYSRPSGQPARDRGLQREGEDGEEKERNGAKKVAPDSVRPSPLGSYSPVRHGAPSS
ETCSTCTPSPDKGHSTSQPTRSLSCPLSASLLPVRPSPVPCGIVLPPGNANQTREFRNAF
FSSLSPCLSLPLPAHLFVRLLAPPPANHLSPQALKWREYRRKNPLGVDRAVGAPLSGSLD
TRRPEGRLTRRNVFDFPASAIHAHSRLNGAGQSMKQLQNYYSDFFPDYFSLTERPPEEFC
LSPDATAESISIDLLQKKGLVKTVNTAVDLIVAHFGTSRDPGVKAKLGNSSVSPNIGHLI
LKYLCPAMREILQDGLKPYVLDMIIGQRKSVPWSVVEASTQLGPSTRVLHSLYSKVSQYS
ELTSHSMRFNAFIFGLLNLHSLEFWFNHLYMHEDIVGAHYHPWGFLPLSQGVCQPLFEEL
LLLLQPLSLLPFDLDLLFEPRLLQKGQEQRRRKEQLCSAGQGLEQSVRSTFQLMRGRGPA
PPPREGAELRKEGAETERAKGVGGESWWDREEGEREKRKEQQMPEEARQRDRQAGWWYQL
MQSSQVYIDNSAEGAKFVKWEKRKKPAGRRQAQPPPREGVVEGAEASQETDARKESSSDL
SWSGKGKPSWMGSPPDSVLNELKQSKEKEPEMPGAGVTCGSQEEVTSEGATQGLRWGRLF
GAGVRSPSRLQKAERAQKSRLPSGWLSLDRSMLDLVAQTMGAGKRTDLPPQQQALPSTEV
RALCHHIATEPGQLSFNKGDILRVLSRAEPDWLYCAQGDSYGLVPIIYVTLLEGLQGN
Download sequence
Identical sequences W5MAM7
ENSLOCP00000005436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]