SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005456 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005456
Domain Number 1 Region: 1418-1505
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000123
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 968-1145
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000017
Family RUN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005456   Gene: ENSLOCG00000004546   Transcript: ENSLOCT00000005464
Sequence length 1508
Comment pep:known_by_projection chromosome:LepOcu1:LG2:11337939:11354345:1 gene:ENSLOCG00000004546 transcript:ENSLOCT00000005464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTSPPISCTKRMDSPPKLSGETLIVHHIPLVHCQVPGRQCCGSLKRTNPFCQPDLGLTR
TTSLPERDVLHREALVYSSLIQTSSSSGGGGGGSSLKSRDPTGKANVLRHNPFLLDAEDD
EGEELGGDEGDNLNGYLEDSSFHLHGNTNAASNKTSSFHLHDLALAAEPFLLHDSLRGVH
KTWCTLSGRPGVAEGHEADSLDLLELDCQGRHGSSGSTLSMDCGEQEWIGSPTEEEEDPL
RNGHCSRPCSCCSSSDFALHGQGHRCCCFSFSEPSENADHQMGYVSDSSCNSSDGVLVNF
SAIYNKMNNGGPAKPLNLNSEDQSCTSSVCSHSEAGGAFYLDLHTSPTEPRGGTNSSQDA
NTCSCHSPQAVDANCNSYHLHCDGGSCHTETSDLTSCFQSQARLVVATQNYYKLVTCDLS
SQSSPSPAGSSITSCSEEQPKSSPSQPTEYYLFRKNCFQCSKEKEGGKSGEEVLEPPQNV
IEGQLYYDRNLDRSPPPRLGSLERMLSCPVRLSDSAARASPPPRVTSFAEIARSKRKSAS
LGGGSPPPKSSTSSSSQEFSPIPEPRHAGESRSLPPMPFGRCYSQSSVDLTPHAGPQDPN
CVGSLFKGSASCRFKKAFTRPNCRSGMRCLLYPLPGSRFPPPPMKRKMFSDYVFGGSSEG
RPVVRYSKDQRPTTLPIQPFIFQHQLSKQPKLRPLLSDYVSQMYSRPSGQPARDRGLQRE
GEDGEEKERNGAKKVAPDSVRPSPLGSYSPVRHGAPSSETCSTCTPSPDKGHSTSQPTRS
LSCPLSASLLPVRPSPVPCGIVLPPGNANQTREFSSLPTLPTSGFSPLGHLEPAQRCGSS
EGVRASAANCMGAPNHLSPQALKWREYRRKNPLGVDRAVGAPLSGSLDTRRPEGRLTRRN
VFDFPASAAANWCVLVSSTGQSMKQLQNYYSDFFPDYFSLTERPPEEFCLSPDATAESIS
IDLLQKKGLVKTVNTAVDLIVAHFGTSRDPGVKAKLGNSSVSPNIGHLILKYLCPAMREI
LQDGLKPYVLDMIIGQRKSVPWSVVEASTQLGPSTRVLHSLYSKVSQYSELTSHSMRFNA
FIFGLLNLHSLEFWFNHLYMHEDIVGAHYHPWGFLPLSQGVCQPLFEELLLLLQPLSLLP
FDLDLLFEPRLLQKGQEQRRRKEQLCSAGQGLEQSVRSTFQLMRGRGPAPPPREGAELRK
EGAETEVRQPGPRVDPNATEAEQGRERSGERRRTGRATEGLRECGRDRQAGWWYQLMQSS
QVYIDNSAEGAKFVKWEKRKKPAGRRQAQPPPREGVVEGAEASQETDARKESSSDLSWSG
KGKPSWMGSPPDSVLNELKQSKEKEPEMPGAGVTCGSQEEVTSEGATQGLRWGRLFGAGV
RSPSRLQKAELPSGWLSLDRSMLDLVAQTMGAGKRTDLPPQQQALPSTKEQGPAQQPEAQ
APKQQALWEVRALCHHIATEPGQLSFNKGDILRVLSRAEPDWLYCAQGDSYGLVPIIYVT
LLEGLQGN
Download sequence
Identical sequences W5MAP7
ENSLOCP00000005456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]