SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000005633 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000005633
Domain Number 1 Region: 135-307
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.48e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 285-403
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.91e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000005633   Gene: ENSLOCG00000004695   Transcript: ENSLOCT00000005641
Sequence length 802
Comment pep:known_by_projection chromosome:LepOcu1:LG10:6454471:6509740:1 gene:ENSLOCG00000004695 transcript:ENSLOCT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGLRSAYQRKERKKVATEKVAGKLSSTLSWVKSAVSHGVGQMASQVVSPSASSLHTTSSS
TTLSTPALSPSSPAQLSPDELELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSS
ASSNLGHLEEDSWILWGRVVNEWEEVRKKKEKQLKELVRKGIPHHFRAIVWQLLCNAQSM
PIKDQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVG
YCQGVLSLSDCCSCRQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQ
LPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLSVATRIFDVFMCEGLEIVFRVGLAILQ
MNQAELMQLDMEGMLQYFQKVIPHQLDSGPDKVIQAAFQVKYNAKKMKKLEKEYTTIKTK
EMEEQVEIKRLRTENRLLKQRIDTLEKKGQVTRAQEAEENYLIKRELATVKQQSDEASAQ
LEQAQSTIRELQQQHRGTFRDAYRLSSLHKLCSVRLSFDKKLKSMCERKQIVIIITDHLY
RHLARTAGRWRDSPRKNALNELQEELMSARLREAESQAELKETRQRMMELETQNQISSNH
LRRAEQELRSVRERVQLLGTQNKGLLAQLQELRRKQAETECKNKEEVMAVRLREADNIAA
MAELQQQIAELEIQKEEGKVQGQLNSSDSSQYVRELKDQIAELEHEIRCLRGQRALSGQP
TFDGIHIVNHYMGDDESYHSSDEEGLAGPVGRSAAASASRPFDPRRDVPRIVLRADLEDT
DSEDDEEPPSLTVPPESYSTTV
Download sequence
Identical sequences W5MB74
ENSLOCP00000005633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]