SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006569 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006569
Domain Number 1 Region: 714-903
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-56
Family Nucleotide and nucleoside kinases 0.0000000987
Further Details:      
 
Domain Number 2 Region: 452-544
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-32
Family PDZ domain 0.0000527
Further Details:      
 
Domain Number 3 Region: 114-219
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-29
Family PDZ domain 0.0000463
Further Details:      
 
Domain Number 4 Region: 547-661,708-742
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-28
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 5 Region: 223-317
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-27
Family PDZ domain 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006569   Gene: ENSLOCG00000005438   Transcript: ENSLOCT00000006577
Sequence length 906
Comment pep:known_by_projection chromosome:LepOcu1:LG3:7683075:7800808:1 gene:ENSLOCG00000005438 transcript:ENSLOCT00000006577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAYLNKQHSCCRDPEGRSIDLVMSDSQCSCGWQHDPQGYFYNSQTLQSSGSTLARSRGK
LSTMRSESIWKSPSKSVAKGKGANSEWWSDCSCPHGWHDSYQASPAPIIVNTETLDTVPY
VNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRV
NDCILRVNDVDVSEVSHSKAVEALKVAGSIVRLYVRRRRPMLETVIEIKLIKGPKGLGFS
IAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILK
NTSDVVYLKVGKPTSVYLTDPYGPPDITHSFSPPMENHISSPGNNGTLEYKSSLPPISPG
RYSPLPKHMLGEEDINRPPEPVYSTVNKLCDKPPSPRHYSPVECDKSLLHSIPFPHYHIG
LLPDSEITRSRSVYKSTVRQPKFTMKYMCADVKEPRKIVLHKGSTGLGFNIVGGEDGEGI
FVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTIIAQYRPEE
YGRFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRALFDYEKTKDSGLPSQGLSFKY
GDILHVINASDDEWWQARRVTPEGDSEEMGVIPSKRSIRRKQSMSVTTIRRPCLHHAFSP
SQSFNDKRKKNFIFSRKFPFYKNKEQSEQETSDAERSQEDLILSYEPVIRQEINYTRPVI
ILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKF
IEAGQYNDNLYGTSVQSVKYVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSIESL
MEMNKRLTEEQAKKTYDRAMKLEQEFGEYFTALVQGNTLEDIYNHCKLVIEEQSGPYIWI
PSKEKL
Download sequence
Identical sequences W5MDW0
ENSLOCP00000006569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]