SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006667 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006667
Domain Number 1 Region: 147-368,412-461
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.05e-49
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 
Domain Number 2 Region: 577-717
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.23e-19
Family Glycerol-3-phosphate transporter 0.026
Further Details:      
 
Domain Number 3 Region: 485-565
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000101
Family Pentapeptide repeats 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006667   Gene: ENSLOCG00000005520   Transcript: ENSLOCT00000006675
Sequence length 728
Comment pep:known_by_projection chromosome:LepOcu1:LG2:14252483:14360822:1 gene:ENSLOCG00000005520 transcript:ENSLOCT00000006675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDTYRDRTSLVKGAKDIAKEAKRQAVKKVSRAVDKAQDEYTQRSYSRFQDEEEDDDYYY
RQDGNYSGAANDEEGSSDATEGHDEEDEIYEGEYQGIPTTGQTKENQVALGQPVPNEYKD
RLELETERKADEEELAQQYELIIQECGHGRFQWQLFFVLGMALMADGVEVFVVGFVLPSA
ETDMCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRRQSLLICMSVNGFFAFLSSFVQ
GYGFFLLCRSISGFGIGGAVPIVFSFFSEVLAREKRGEHLSWLCMFWMIGGIYASAMAWA
IIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVSAVVALTFMPESPRFFLEVGKHDEAWMI
LKQIHDTNMRARGQPEKVFTVNRIKTPKQIDELIEIQSGTGNWFLRCVVRIRTEFYGIWL
TFMRCFNYPVKDNTVKLAIVWFTLSFGYYGLSVWFPDVIKHLQSDEYALKVRTFNTERVE
NSTFNFTLENQIHTNGEFINDRFNSMKFKSVTFINCTFQNCYFDNVTSLGTYFRSCVFIE
NFFVNTDIDDSKFINTETINNTFHQNKTGCQMTFDDDYSAYWVYFVNFLGTLAVLPGNIV
SALLMDKIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVITV
ELYPTDRRATGFGFCNALCKLAAVLGNLIFGSLVGITKAIPILLASTVLVCGGLVGLRLP
DTRSNVLM
Download sequence
Identical sequences W5ME58
ENSLOCP00000006667 XP_006626776.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]