SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007032 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007032
Domain Number 1 Region: 11-74,106-140,206-303
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.41e-44
Family Ypt/Rab-GAP domain of gyp1p 0.00059
Further Details:      
 
Domain Number 2 Region: 281-397
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-33
Family Ypt/Rab-GAP domain of gyp1p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007032   Gene: ENSLOCG00000005818   Transcript: ENSLOCT00000007040
Sequence length 400
Comment pep:known_by_projection chromosome:LepOcu1:LG21:14204737:14213576:-1 gene:ENSLOCG00000005818 transcript:ENSLOCT00000007040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSFWVSRIQEFRAVLSGEKIDLDALRELCFGGIPFEGGIQSLCWKILLNYLPLEQKLWD
SFLKKQRELYTQFLKEMIIQPGIAKANLGLSREDVTLEDHPLNPNPESRWNNYFKDNEVL
LQIDKDVRRLYPDMAFFQRPTDYPCLLILDPQNEYETLRRRVEQTTLKAQTVAKNRSGVT
NVSSPGKSQNLYPSNEYEVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPIYY
TFATDPNSEWKEHAEADTFFCFTNLMSENRDNFIKSLDDSQCGISYKMESVYSTLKEKDM
ELYLKLQEQNIRPQYFTFRWLTLLLSQEFLLPDVIRIWDTLFSDKDRFGFLTLVCCAMLI
LIRDQLLTGDFTVNMRLLQDYPISDVHTILKKAKELQDGA
Download sequence
Identical sequences W5MF73
ENSLOCP00000007032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]