SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007040 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007040
Domain Number 1 Region: 65-167
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-19
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007040   Gene: ENSLOCG00000005812   Transcript: ENSLOCT00000007048
Sequence length 361
Comment pep:novel chromosome:LepOcu1:LG12:12178601:12185419:-1 gene:ENSLOCG00000005812 transcript:ENSLOCT00000007048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFKRLIRQNSNDNYILQNNLRRKTGPCFNNTVDSETDNKRLQKVVATLGTLPRGRKQVA
RSNSLVDYTDSQRTAIIMEKQDNETYGFEIQTYGLQHQNTNTLEMCTFVCKVQEDSPAEN
AGLTPGDVIVAVNGISTEGFSHQHIVDLIKTSASCLRLETINGTAVKRIELETKLKFLKK
TLREKWVELQSLLLQEQRLAHGNLNECSPHSSLDSPMSPMSPGADSLAFSPMLRCKYRFS
SGSSCKSQLSITTEDSEDTFYQASVFEDSNPMSPYRRVSMDDECFFSRDCSTVGLKASVN
RTRSISLASSGSISPSWDVTGSSSLFGTLPRKKQGSVRKRFMKFIPGLNRPVVEEEIHQS
T
Download sequence
Identical sequences W5MF81
ENSLOCP00000007040 XP_006636529.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]