SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007206 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007206
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-24
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 2 Region: 182-264
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000573
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.000000141
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007206   Gene: ENSLOCG00000005945   Transcript: ENSLOCT00000007214
Sequence length 525
Comment pep:known_by_projection chromosome:LepOcu1:LG9:10231925:10319235:-1 gene:ENSLOCG00000005945 transcript:ENSLOCT00000007214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTSSEETKTGIYLLQDGNQEPFNVRLHLAKDILTIQEQDVICVSGEPFYSSERTVTI
RRQTIGGFGLSIKGGAEHNIPVVISKISKEQKAELSGLLFIGDGILQINGINVRNYRHEE
VVQVLRNAGEEVTLTVSFLKKTPAFLKLPLCEDCTCVPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWVDLRLIPLLHSRLSQYIPGTDICRQNAFQVIAVDGVC
SGVIQCLTSEDCLDWLQAIAANISNLTKHNIKKINRNFPVNQQIIYMGWVDEREQDSLQD
RMYTPKFLALRGSSLFKFSAPPVTTWDWTRAEKSFTVYEIMCKILKDSDLLDQRKNCFSL
QTESGEDMFFSVELECELTLWEKAFQTATFLEVERIQCKTYACIMESHLMGLTIDFSMGF
ICFDAASKAVLWRYKFSQLKGSSDDGKSKIKFLFQNQDTKLIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLYVGSQGAAAAAVASAPAPATCAAGTGKIKYST
Download sequence
Identical sequences W5MFP7
ENSLOCP00000007206 XP_006634094.1.81211 XP_015208867.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]