SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007223 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007223
Domain Number 1 Region: 339-535
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 2 Region: 511-620
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007223   Gene: ENSLOCG00000005974   Transcript: ENSLOCT00000007231
Sequence length 658
Comment pep:known_by_projection chromosome:LepOcu1:LG5:8432679:8459674:-1 gene:ENSLOCG00000005974 transcript:ENSLOCT00000007231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNESESLDASADFHGRPDESPGDTEPPAPLGRCGQGSSDGVAPGDALETQAGGPSVCPA
SERGAASPEPSTSPAEPGEHPTKAEEISESSSLRPLTLRTNKNTTACLSCDATPVSPDGG
QVCSGSEEEHDPRFMDVAVGSRNTFEVSRRQSAPDNLPDGLSLPADSSAEQGSKPKKLGI
SDFFSRSLFSRKGKEPKTPSQSVPGWKLFGKVPLRENTQKDSKTIQQDSNPGNLTSVSTP
NLLSTGEYEARTGKASNPPPQPGRRKNLEFEPLSTTALILEDRPANLPAKSAVEAQRHRQ
EYDEMVAEAKKREMKEAQKKKKIMKERYKQEEIIANAMVIWNTEILPNWETMRNTRKVRE
LWWQGLPPSVRGKVWSLAIGNELNITHELYEIFLSRAKERWKSFSETGSENEAEDSGVSL
ADRESSLELIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAV
LILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAAFEVFFDENLPRLFAHFQSYN
LTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTGLGILKLYEDILLQMDFI
HIAQFLTRLPEETTSEKLFSCIAAVQMLSSNKKWIQVFTALMKDSKELDKNNSPAQKS
Download sequence
Identical sequences W5MFR4
ENSLOCP00000007223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]