SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007246 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007246
Domain Number 1 Region: 111-204
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.0000888
Further Details:      
 
Domain Number 2 Region: 197-296
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000749
Family PDZ domain 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007246   Gene: ENSLOCG00000005990   Transcript: ENSLOCT00000007254
Sequence length 300
Comment pep:known_by_projection chromosome:LepOcu1:LG18:12309472:12319846:-1 gene:ENSLOCG00000005990 transcript:ENSLOCT00000007254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYPSLEDLKVDKVMKAQASFAAKTSSPAITEGAPEEMPAGLGAPSSVLYPDLQELGEY
MGLRLNSDEVRNNMALVPAADNQVATAPSAMGGMVCPVTGGDVGVRRAEIKQGLREVILC
KDQDGKMGLRLRSIDNGVFIQLVQANSPAALAGLRFGDQVLQINGQNCAGWSQDTAHKML
KVAAEDRIELIVRDRPFQRTITMHKDSSGHVGFIFKNGKVTSIVKDSSAARNGLLTEHNI
CEINGQNVIGLKDPQIKDILTASSSAITITVMPKIIFEHMVKRMSAGLIKSVMDHSIPEV
Download sequence
Identical sequences W5MFT7
ENSLOCP00000007246 XP_006639695.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]