SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007762 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007762
Domain Number 1 Region: 165-311
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.01e-25
Family Reductases 0.017
Further Details:      
 
Domain Number 2 Region: 64-153
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000158
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007762   Gene: ENSLOCG00000006425   Transcript: ENSLOCT00000007771
Sequence length 312
Comment pep:known_by_projection chromosome:LepOcu1:LG11:18583696:18599812:1 gene:ENSLOCG00000006425 transcript:ENSLOCT00000007771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAVSVNCLLGRAAGTFTLQVASALLRPRPLCACVINRKMSSRRKTDHLERTANNYRQ
EVLYPAKVCGILNESNNVKRLRLAIPDKDFTFKAGQWVDFLIPGLSKVGGFSICSSPRLL
EGEGVIELAVKYSAHPPAHWIHTECTLDSEIAVRVGGDFYFDPQPSDPAVNLLLVAGGVG
INPLFSILLHVADLYRQREREGSGYEPCSVKLFYSAKNTEELLFKNTIIGLSKEFFEKVS
CNFHVTQQETEIDTHLRPYISEGRISQKILKEHLSENTLCFICGPPPMIEYVSGQLQCLG
LSEEKILFEKWW
Download sequence
Identical sequences W5MHA3
ENSLOCP00000007762 XP_015212958.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]