SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007869 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007869
Domain Number 1 Region: 24-178,206-225
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0027
Further Details:      
 
Domain Number 2 Region: 262-372
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007869   Gene: ENSLOCG00000006501   Transcript: ENSLOCT00000007879
Sequence length 778
Comment pep:known_by_projection chromosome:LepOcu1:LG11:18878312:18973590:-1 gene:ENSLOCG00000006501 transcript:ENSLOCT00000007879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTYIWCKRTFRSYSKEWDELFLNCNYLARIRQKGINGQLRSSRFRSVCWKLYLDVLPED
KSQWINKTKELRAQYEKIKETHITNPRKAAGQQDLVVNNPLSQDEGSLWNKFFQDKELRG
MIQQDVMRTFPEMQYFQQDAVRNMLTDILFCYARENEQLLYKQGMHELLAPIVFILHCDH
QAFQHASETAYPSEEMKSLLNPAFHEHDAYAMFSQLMETAEPWFSTFERQVRKGKEEMIT
SIPFARPQDTGPSVAVVTKVNRIQDQLIKKHDIELYMHLNRLEIAPQIYGIRWVRLLFGR
EFPLQDLLVVWDALFADSITLDLVDYIFVAMLLYIRDALIASNYQTCLGLLMHYPPIGDI
HALLQKALFLRDPKNNPRPVNYQFQQNLDYYKTRGADLMSKTRASAKAAPLNINKVSSSL
LSFGRKLIAPAISVSASTVSPINSDVSTVAAPTVTRSMVESSQIQQQPQQQAQHHRLLKS
ESMPVHLSKDVVTGGGAQVSIPVQTVTDIQGQSSKNVSSSPSIESLPGGRDHTASPPLSA
TKKDSFFNISRSRSHSKTMGKKDSEEDLEAQISFLQGQLNDLEAMCKYCAKMMNLHIGKI
QEVILQENLEKEDEVLVSLAGLKQIKDILKGSLRFNQSQLEAEENEEITIADDHYCSSTQ
KGDRKSNSNTYTATSESSLNSEGRNSDDYILISQDDDVEQDPEEKKDITASTAKVPSFPK
GVKVTPKPEKEAPPSAVFQDPLMTMASASGSTSGSSPDDDSSNSKDCDFTIVNPMDLS
Download sequence
Identical sequences W5MHL0
ENSLOCP00000007869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]