SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007938 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007938
Domain Number 1 Region: 128-299
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 2 Region: 925-982
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 967-1019
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 859-881,912-939
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000415
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 5 Region: 278-394
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000366
Family Ypt/Rab-GAP domain of gyp1p 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007938   Gene: ENSLOCG00000006572   Transcript: ENSLOCT00000007948
Sequence length 1034
Comment pep:known_by_projection chromosome:LepOcu1:LG6:13200270:13247950:1 gene:ENSLOCG00000006572 transcript:ENSLOCT00000007948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRSSPPPPSDSDPAGSPEQDPERSLSPPALDPDPPSTGSPVLSPDSSSQDAMLSAPA
CSPADSENLSPDELELLAKLEEQNRLLEADSKSMRSMSGSRRNSGSSLVSSSSASSNLSH
LEEDTWILWGRIVNEWEEWRRKKDKLLKELIRKGIPHHFRAIVWQLLCNATDMPVKNQYS
ELLKMSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAF
IVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYLLQCRSREIQKHR
CRCSHVKIHIFENMLLLSLKFVPYLPCSRIFALFHYDGLEIIFRVGMAILQNNQTDLIQL
DMEGMSQHFQKVIPHQFDNWPDKLILRAYQVKYNPKRMKKLEKEYTTIKNKEMEEQIEIK
RLRTENRLLKQRIETLEKESAALADRLIQGQVTRALEAEENYVIKRELAVVRQQCSTASE
SLERAQDTIRELQQHQYTEQFVSGLQTELEQSTDPSVSNLGVLEYNRDTSLLSDSETLHS
GLSHFITVTPSLSNSEIVKHEQIENPDSARVCAEVLLNLTHLPRDHTAADGHAVGGGAAK
VALRWSGAMDNLQLSQIIQRIRKSKQCLSQRDVEDRSISLMLQINSSLRMMVEREAESNQ
PTTRNALQHTRVELSHSIMFMGDSDCRAEEPGEQGEREEERREGEQGEREEEERDEREEE
EMKRRRGRSNEKRGRRRVEEQREEERRREGEVGRIRGRKRREGGGGEKERGCGVLACADP
GGGEVSEFCPLPSDPHLSPPPEVQSALSAPRPPCLPWAPLQESPEREGDLEKLLRALLSE
SRGQGESGEPLGCKLAPGRCPLCGKLFSSSPGLETHLRRSHVSRLALPLAGYTKASSQSY
GFRPELGIQCRVKERSFSCKVCGKVFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDM
KKHTFIHTGEKPHVCQVCGKAFSQSSNLITHSRKHSGYKPFSCPSCSRGFQRKVDLRRHQ
EAHCGYSMAINTQS
Download sequence
Identical sequences W5MHS9
ENSLOCP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]