SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009067 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009067
Domain Number 1 Region: 11-185
Classification Level Classification E-value
Superfamily RUN domain-like 8.11e-40
Family RUN domain 0.001
Further Details:      
 
Domain Number 2 Region: 648-738
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009067   Gene: ENSLOCG00000007467   Transcript: ENSLOCT00000009078
Sequence length 806
Comment pep:known_by_projection chromosome:LepOcu1:LG13:14160090:14265048:1 gene:ENSLOCG00000007467 transcript:ENSLOCT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAQQNDIKRQHLLERLLDAVKQCQIRFGGRKEIASDSDSRVICLCAQFEAMLQHGLRR
SRGLALTAAAFKQVAGFSSKAESELSFWLYVKEHLNRHELQRFYALRQISSEVGRGRAWL
RCALNEHSLERYLHALLADRARLSVFYEDWAFLMDEERASMLPIMAAGLNSILFAINIDN
TDLNGQSRGAPSVSDLLRESTQGVSSLWKESAQGVSTLLREISTATSAVPGFGPRAEHLS
DPLPVLPRSASADSGLKKERRRKKKVTHIISFDDDEEEEGEGGGRLRKGSGRGPGGSEEA
LEVSDPPPTQNGAPDGEVGGWGGPHTTNGEPIDSKSIDNEEEEEEDLYGRSRPEVEEERG
NGEQPLVGSLSSVSTWSPLQVINDNDGSDILIPVDSADSCSQPEGEVQTRGYREVTGRSE
VTQTEPRLGYSTDTSPAAQSTPLNISSPVLPESMTVAELRQAIVAMMNRKDELEEENRSL
RSLLDGEMEHSAGLRQELDSLKKRLGELEERHGAKVQALGRENEVLKVQLKKYVGAVQML
KREGGQSDDALPALGNGDGAPPAPPPKPAGEVEELAASYERKLIEVAEMHGELIEFNERL
YRSLMAKDNLISQMRQELIDLRGPVPGDLSQTSEDPSLSDFETAHRALVNVWIPSVFLRG
RAANAYHVYQVYIRILDNEWNVYRRYTDFRALHQRLRSRFPQVDAFNFPPKKAIGNKDSK
FVEERRKQLQSYLRSVMNKLIQALPEFAARPTKETLLKLLPFCQDTPQATESGTKPARSR
VGPRFPKLTRSQNRESRNPEPQSGDL
Download sequence
Identical sequences W5ML08
ENSLOCP00000009067 XP_015215683.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]