SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009207 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009207
Domain Number 1 Region: 53-207
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0075
Further Details:      
 
Domain Number 2 Region: 188-304
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-17
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009207   Gene: ENSLOCG00000007587   Transcript: ENSLOCT00000009218
Sequence length 403
Comment pep:known_by_projection chromosome:LepOcu1:LG11:23105527:23126220:-1 gene:ENSLOCG00000007587 transcript:ENSLOCT00000009218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKGKKHQQNTGSQVTGNGTVKKQGEHESKKKQKLVEIHRALNSDPVDIETLRRAAVSEG
GLVADEIRRKVWPKLLSVNVYNLPPRPGKDVRESHKDYNQVLLDVRRSMRRFPKGMRAEQ
REVLQEQLTDIILDVLKRNPQLHYYQGYHDIVVTFLLVVGERMAAAMVDTLSNHHLRDFM
DPTMDSTKHILNYLMPILEEVDPELHDFMQRAEVGTIFALSWLITWYGHVLSDFRHVLRL
YDFFLASHPLMAIYFAAVIVLYREKEVKSCDCDMASVHHLLSQIPQNLPYEELISTAQEL
FTRYPPVVLAKKAALQPRESITISSFKDFQMATLQQRPDTVLRQQLRDRASSDLAVPEEV
APAGTSQLVKMAVWGISATLGAAALAVAQTALDWAPEFLLQLF
Download sequence
Identical sequences W5MLE8
ENSLOCP00000009207 XP_006635905.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]